Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein RNA-binding region containing protein 1 [143360] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143361] (1 PDB entry) Uniprot Q9H0Z9 1-103 |
Domain d2cqda1: 2cqd A:1-103 [130719] Other proteins in same PDB: d2cqda2, d2cqda3 |
PDB Entry: 2cqd (more details)
SCOPe Domain Sequences for d2cqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} mhgsqkdttftkifvgglpyhttdaslrkyfegfgdieeavvitdrqtgksrgygfvtma draaaerackdpnpiidgrkanvnlaylgakprslqtgfaigv
Timeline for d2cqda1: