Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Arginine/serine-rich splicing factor 10 [143312] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143313] (1 PDB entry) Uniprot P62995 109-191 |
Domain d2cqca1: 2cqc A:110-191 [130718] Other proteins in same PDB: d2cqca2, d2cqca3 |
PDB Entry: 2cqc (more details)
SCOPe Domain Sequences for d2cqca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqca1 d.58.7.1 (A:110-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} nranpdpncclgvfglslytterdlrevfskygpiadvsivydqqsrrsrgfafvyfenv ddakeakerangmeldgrrirv
Timeline for d2cqca1: