Lineage for d2cqca1 (2cqc A:110-191)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2558725Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2558726Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2558733Protein Arginine/serine-rich splicing factor 10 [143312] (1 species)
  7. 2558734Species Human (Homo sapiens) [TaxId:9606] [143313] (1 PDB entry)
    Uniprot P62995 109-191
  8. 2558735Domain d2cqca1: 2cqc A:110-191 [130718]
    Other proteins in same PDB: d2cqca2, d2cqca3

Details for d2cqca1

PDB Entry: 2cqc (more details)

PDB Description: solution structure of the rna recognition motif in arginine/serine- rich splicing factor 10
PDB Compounds: (A:) Arginine/serine-rich splicing factor 10

SCOPe Domain Sequences for d2cqca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqca1 d.58.7.1 (A:110-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]}
nranpdpncclgvfglslytterdlrevfskygpiadvsivydqqsrrsrgfafvyfenv
ddakeakerangmeldgrrirv

SCOPe Domain Coordinates for d2cqca1:

Click to download the PDB-style file with coordinates for d2cqca1.
(The format of our PDB-style files is described here.)

Timeline for d2cqca1: