Lineage for d2cqba1 (2cqb A:1-89)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724461Protein Peptidyl-prolyl cis-trans isomerase E, N-terminal domain [143310] (1 species)
  7. 724462Species Human (Homo sapiens) [TaxId:9606] [143311] (1 PDB entry)
  8. 724463Domain d2cqba1: 2cqb A:1-89 [130717]

Details for d2cqba1

PDB Entry: 2cqb (more details)

PDB Description: solution structure of the rna recognition motif in peptidyl-prolyl cis-trans isomerase e
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOP Domain Sequences for d2cqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mattkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaeda
aaaidnmneselfgrtirvnlakpmrike

SCOP Domain Coordinates for d2cqba1:

Click to download the PDB-style file with coordinates for d2cqba1.
(The format of our PDB-style files is described here.)

Timeline for d2cqba1: