Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.14: TIP49 domain [141315] (1 protein) N-terminal part of Pfam PF06068; the RuvA-like OB-fold domain in RuvB-like eukaryotic proteins |
Protein RuvB-like 2 protein, RUVBL2 (TIP49b) [141316] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141317] (1 PDB entry) Uniprot Q9Y230 131-212 |
Domain d2cqaa1: 2cqa A:8-89 [130716] Other proteins in same PDB: d2cqaa2, d2cqaa3 |
PDB Entry: 2cqa (more details)
SCOPe Domain Sequences for d2cqaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cqaa1 b.40.4.14 (A:8-89) RuvB-like 2 protein, RUVBL2 (TIP49b) {Human (Homo sapiens) [TaxId: 9606]} keeteiiegevveiqidrpatgtgskvgkltlkttemetiydlgtkmiesltkdkvqagd vitidkatgkisklgrsftrar
Timeline for d2cqaa1: