Lineage for d2cq4a1 (2cq4 A:132-232)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952115Protein RNA binding protein 23 [143352] (1 species)
  7. 2952116Species Human (Homo sapiens) [TaxId:9606] [143353] (2 PDB entries)
    Uniprot Q86U06 148-248
  8. 2952118Domain d2cq4a1: 2cq4 A:132-232 [130715]
    Other proteins in same PDB: d2cq4a2, d2cq4a3
    1st RBD

Details for d2cq4a1

PDB Entry: 2cq4 (more details)

PDB Description: solution structure of rna binding domain in rna binding motif protein 23
PDB Compounds: (A:) RNA binding motif protein 23

SCOPe Domain Sequences for d2cq4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]}
kspvrepvdnlspeerdartvfcmqlaarirprdledffsavgkvrdvriisdrnsrrsk
giayvefceiqsvplaigltgqrllgvpiivqasqaeknrl

SCOPe Domain Coordinates for d2cq4a1:

Click to download the PDB-style file with coordinates for d2cq4a1.
(The format of our PDB-style files is described here.)

Timeline for d2cq4a1: