Lineage for d2cq3a1 (2cq3 A:110-202)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 724300Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 724301Family d.58.7.1: Canonical RBD [54929] (67 proteins)
  6. 724556Protein RNA-binding protein 9 [143314] (1 species)
  7. 724557Species Human (Homo sapiens) [TaxId:9606] [143315] (1 PDB entry)
  8. 724558Domain d2cq3a1: 2cq3 A:110-202 [130714]

Details for d2cq3a1

PDB Entry: 2cq3 (more details)

PDB Description: solution structure of rna binding domain in rna binding motif protein 9
PDB Compounds: (A:) RNA-binding protein 9

SCOP Domain Sequences for d2cq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}
ssgnseskstpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfen
sadadrareklhgtvvegrkievnnatarvmtn

SCOP Domain Coordinates for d2cq3a1:

Click to download the PDB-style file with coordinates for d2cq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2cq3a1: