Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein RNA-binding protein 9 [143314] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143315] (1 PDB entry) |
Domain d2cq3a1: 2cq3 A:110-202 [130714] |
PDB Entry: 2cq3 (more details)
SCOP Domain Sequences for d2cq3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} ssgnseskstpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfen sadadrareklhgtvvegrkievnnatarvmtn
Timeline for d2cq3a1: