Lineage for d2cq3a1 (2cq3 A:113-202)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952151Protein RNA-binding protein 9 [143314] (1 species)
  7. 2952152Species Human (Homo sapiens) [TaxId:9606] [143315] (1 PDB entry)
    Uniprot O43251 110-202
  8. 2952153Domain d2cq3a1: 2cq3 A:113-202 [130714]
    Other proteins in same PDB: d2cq3a2, d2cq3a3

Details for d2cq3a1

PDB Entry: 2cq3 (more details)

PDB Description: solution structure of rna binding domain in rna binding motif protein 9
PDB Compounds: (A:) RNA-binding protein 9

SCOPe Domain Sequences for d2cq3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cq3a1 d.58.7.1 (A:113-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]}
nseskstpkrlhvsnipfrfrdpdlrqmfgqfgkildveiifnergskgfgfvtfensad
adrareklhgtvvegrkievnnatarvmtn

SCOPe Domain Coordinates for d2cq3a1:

Click to download the PDB-style file with coordinates for d2cq3a1.
(The format of our PDB-style files is described here.)

Timeline for d2cq3a1: