Lineage for d2cq2a1 (2cq2 A:25-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951862Protein Alkylation repair AlkB homolog 8, ALKBH8 [143334] (1 species)
  7. 2951863Species Human (Homo sapiens) [TaxId:9606] [143335] (1 PDB entry)
    Uniprot Q96BT7 25-125
  8. 2951864Domain d2cq2a1: 2cq2 A:25-125 [130713]
    Other proteins in same PDB: d2cq2a2, d2cq2a3

Details for d2cq2a1

PDB Entry: 2cq2 (more details)

PDB Description: solution structure of rna binding domain in hypothetical protein loc91801
PDB Compounds: (A:) hypothetical protein LOC91801

SCOPe Domain Sequences for d2cq2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]}
akhtllrhegietvsyatqslvvangglgngvsrnqllpvlekcglvdallmppnkpysf
aryrtteeskrayvtlngkevvddlgqkitlylnfvekvqw

SCOPe Domain Coordinates for d2cq2a1:

Click to download the PDB-style file with coordinates for d2cq2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cq2a1: