![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Alkylation repair AlkB homolog 8, ALKBH8 [143334] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143335] (1 PDB entry) Uniprot Q96BT7 25-125 |
![]() | Domain d2cq2a1: 2cq2 A:25-125 [130713] Other proteins in same PDB: d2cq2a2, d2cq2a3 |
PDB Entry: 2cq2 (more details)
SCOPe Domain Sequences for d2cq2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} akhtllrhegietvsyatqslvvangglgngvsrnqllpvlekcglvdallmppnkpysf aryrtteeskrayvtlngkevvddlgqkitlylnfvekvqw
Timeline for d2cq2a1: