Lineage for d2cq0a1 (2cq0 A:231-320)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2172288Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2174486Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2174487Family d.58.7.1: Canonical RBD [54929] (68 protein domains)
  6. 2174528Protein Eukaryotic translation initiation factor 3 subunit 4 [143304] (1 species)
  7. 2174529Species Human (Homo sapiens) [TaxId:9606] [143305] (1 PDB entry)
    Uniprot O75821 231-320
  8. 2174530Domain d2cq0a1: 2cq0 A:231-320 [130711]
    Other proteins in same PDB: d2cq0a2, d2cq0a3

Details for d2cq0a1

PDB Entry: 2cq0 (more details)

PDB Description: solution structure of RNA binding domain in eukaryotic translation initiation factor 3 subunit 4
PDB Compounds: (A:) Eukaryotic translation initiation factor 3 subunit 4

SCOPe Domain Sequences for d2cq0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]}
pnrraddnatirvtnlsedtretdlqelfrpfgsisriylakdkttgqskgfafisfhrr
edaaraiagvsgfgydhlilnvewakpstn

SCOPe Domain Coordinates for d2cq0a1:

Click to download the PDB-style file with coordinates for d2cq0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cq0a1: