Lineage for d2cpza1 (2cpz A:383-484)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951897Protein CUG triplet repeat RNA-binding protein 1 [143336] (1 species)
  7. 2951898Species Human (Homo sapiens) [TaxId:9606] [143337] (2 PDB entries)
    Uniprot Q92879 383-484
  8. 2951900Domain d2cpza1: 2cpz A:383-484 [130710]
    Other proteins in same PDB: d2cpza2, d2cpza3
    3rdRBD

Details for d2cpza1

PDB Entry: 2cpz (more details)

PDB Description: solution structure of rna binding domain 3 in cug triplet repeat rna- binding protein 1
PDB Compounds: (A:) CUG triplet repeat RNA-binding protein 1

SCOPe Domain Sequences for d2cpza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]}
ltqqsigaagsqkegpeganlfiyhlpqefgdqdllqmfmpfgnvvsakvfidkqtnlsk
cfgfvsydnpvsaqaaiqsmngfqigmkrlkvqlkrskndsk

SCOPe Domain Coordinates for d2cpza1:

Click to download the PDB-style file with coordinates for d2cpza1.
(The format of our PDB-style files is described here.)

Timeline for d2cpza1: