Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein RNA-binding protein 12 [143349] (2 species) 3rd RBD |
Species Human (Homo sapiens) [TaxId:9606] [143350] (3 PDB entries) Uniprot Q9NTZ6 412-523! Uniprot Q9NTZ6 536-638 |
Domain d2cpya1: 2cpy A:536-638 [130709] 2nd RBD |
PDB Entry: 2cpy (more details)
SCOPe Domain Sequences for d2cpya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} egdvnsakvcahitnipfsitkmdvlqflegipvdenavhvlvdnngqglgqalvqfkne ddarkserlhrkklngreafvhvvtledmreieknppaqgksg
Timeline for d2cpya1: