Lineage for d2cpxa1 (2cpx A:291-392)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952135Protein RNA-binding protein 41, RBM41 [143296] (1 species)
  7. 2952136Species Human (Homo sapiens) [TaxId:9606] [143297] (1 PDB entry)
    Uniprot Q96IZ5 291-392
  8. 2952137Domain d2cpxa1: 2cpx A:291-392 [130708]
    Other proteins in same PDB: d2cpxa2, d2cpxa3

Details for d2cpxa1

PDB Entry: 2cpx (more details)

PDB Description: solution structure of rna binding domain in hypothetical protein flj11016
PDB Compounds: (A:) Hypothetical protein FLJ11016

SCOPe Domain Sequences for d2cpxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}
eeirkipmfssynpgepnkvlylknlsprvterdlvslfarfqekkgppiqfrmmtgrmr
gqafitfpnkeiawqalhlvngyklygkilviefgknkkqrs

SCOPe Domain Coordinates for d2cpxa1:

Click to download the PDB-style file with coordinates for d2cpxa1.
(The format of our PDB-style files is described here.)

Timeline for d2cpxa1: