Lineage for d2cpta1 (2cpt A:8-111)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2309866Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2310255Superfamily a.7.14: MIT domain [116846] (2 families) (S)
  5. 2310256Family a.7.14.1: MIT domain [116847] (4 proteins)
    Pfam PF04212
    this is a repeat family; one repeat unit is 1wr0 A:5-81 found in domain
  6. 2310263Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species)
  7. 2310264Species Human (Homo sapiens) [TaxId:9606] [140355] (4 PDB entries)
    Uniprot O75351 1-104! Uniprot O75351 1-77
  8. 2310268Domain d2cpta1: 2cpt A:8-111 [130706]
    Other proteins in same PDB: d2cpta2, d2cpta3

Details for d2cpta1

PDB Entry: 2cpt (more details)

PDB Description: solution structure of mit domain from human skd1
PDB Compounds: (A:) Vacuolar sorting protein 4b

SCOPe Domain Sequences for d2cpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpta1 a.7.14.1 (A:8-111) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]}
msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
kcteyldraeklkeylknkekkaqkpvkegqpspadekgndsdg

SCOPe Domain Coordinates for d2cpta1:

Click to download the PDB-style file with coordinates for d2cpta1.
(The format of our PDB-style files is described here.)

Timeline for d2cpta1: