Lineage for d2cpta1 (2cpt A:8-111)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636659Fold a.7: Spectrin repeat-like [46965] (15 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 636895Superfamily a.7.14: MIT domain [116846] (1 family) (S)
  5. 636896Family a.7.14.1: MIT domain [116847] (3 proteins)
    Pfam PF04212
  6. 636903Protein Vacuolar sorting protein 4b (VPS4B, SKD1 protein) [140354] (1 species)
  7. 636904Species Human (Homo sapiens) [TaxId:9606] [140355] (2 PDB entries)
  8. 636905Domain d2cpta1: 2cpt A:8-111 [130706]

Details for d2cpta1

PDB Entry: 2cpt (more details)

PDB Description: Solution structure of MIT domain from human SKD1
PDB Compounds: (A:) Vacuolar sorting protein 4b

SCOP Domain Sequences for d2cpta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpta1 a.7.14.1 (A:8-111) Vacuolar sorting protein 4b (VPS4B, SKD1 protein) {Human (Homo sapiens) [TaxId: 9606]}
msstspnlqkaidlaskaaqedkagnyeealqlyqhavqyflhvvkyeaqgdkakqsira
kcteyldraeklkeylknkekkaqkpvkegqpspadekgndsdg

SCOP Domain Coordinates for d2cpta1:

Click to download the PDB-style file with coordinates for d2cpta1.
(The format of our PDB-style files is described here.)

Timeline for d2cpta1: