| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily) beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) ![]() Prokaryotic and eukaryotic domains share a KH-motif but have different topologies |
| Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins) an RNA-binding domain |
| Protein Fragile X mental retardation syndrome related protein 1, FXR1 [143222] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [143223] (1 PDB entry) Uniprot P51114 212-289 |
| Domain d2cpqa1: 2cpq A:212-289 [130704] Other proteins in same PDB: d2cpqa2, d2cpqa3 1st KH domain |
PDB Entry: 2cpq (more details)
SCOPe Domain Sequences for d2cpqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]}
tkqlaaafheefvvredlmglaigthgsniqqarkvpgvtaieldedtgtfriygesada
vkkargflefvedfiqvp
Timeline for d2cpqa1: