Lineage for d2cpqa1 (2cpq A:212-289)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947085Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2947086Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2947087Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2947107Protein Fragile X mental retardation syndrome related protein 1, FXR1 [143222] (1 species)
  7. 2947108Species Human (Homo sapiens) [TaxId:9606] [143223] (1 PDB entry)
    Uniprot P51114 212-289
  8. 2947109Domain d2cpqa1: 2cpq A:212-289 [130704]
    Other proteins in same PDB: d2cpqa2, d2cpqa3
    1st KH domain

Details for d2cpqa1

PDB Entry: 2cpq (more details)

PDB Description: solution structure of the n-terminal kh domain of human fxr1
PDB Compounds: (A:) Fragile X mental retardation syndrome related protein 1, isoform b'

SCOPe Domain Sequences for d2cpqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]}
tkqlaaafheefvvredlmglaigthgsniqqarkvpgvtaieldedtgtfriygesada
vkkargflefvedfiqvp

SCOPe Domain Coordinates for d2cpqa1:

Click to download the PDB-style file with coordinates for d2cpqa1.
(The format of our PDB-style files is described here.)

Timeline for d2cpqa1: