Lineage for d2cpna1 (2cpn A:150-225)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 722458Fold d.50: dsRBD-like [54767] (5 superfamilies)
    alpha-beta(3)-alpha; 2 layers: alpha/beta
  4. 722459Superfamily d.50.1: dsRNA-binding domain-like [54768] (3 families) (S)
  5. 722460Family d.50.1.1: Double-stranded RNA-binding domain (dsRBD) [54769] (12 proteins)
    Pfam PF00035
  6. 722519Protein TAR RNA-binding protein 2 [143208] (1 species)
    duplication: contains three dsRBD
  7. 722520Species Human (Homo sapiens) [TaxId:9606] [143209] (1 PDB entry)
  8. 722521Domain d2cpna1: 2cpn A:150-225 [130703]
    2nd dsRBD

Details for d2cpna1

PDB Entry: 2cpn (more details)

PDB Description: solution structure of the second dsrbd of tar rna-binding protein 2
PDB Compounds: (A:) TAR RNA-binding protein 2

SCOP Domain Sequences for d2cpna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpna1 d.50.1.1 (A:150-225) TAR RNA-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]}
pvspqqsecnpvgalqelvvqkgwrlpeytvtqesgpahrkeftmtcrverfieigsgts
kklakrnaaakmllrv

SCOP Domain Coordinates for d2cpna1:

Click to download the PDB-style file with coordinates for d2cpna1.
(The format of our PDB-style files is described here.)

Timeline for d2cpna1: