Lineage for d2cpia1 (2cpi A:101-189)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2516578Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2518968Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2518969Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2519007Protein E3 ubiquitin protein ligase CNOT4 [143294] (1 species)
    CCR4-NOT transcription complex subunit 4
  7. 2519008Species Mouse (Mus musculus) [TaxId:10090] [143295] (1 PDB entry)
    Uniprot Q8BT14 101-198
  8. 2519009Domain d2cpia1: 2cpi A:101-189 [130701]
    Other proteins in same PDB: d2cpia2, d2cpia3

Details for d2cpia1

PDB Entry: 2cpi (more details)

PDB Description: Solution structure of the RNA recognition motif of CNOT4
PDB Compounds: (A:) CCR4-NOT transcription complex subunit 4

SCOPe Domain Sequences for d2cpia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]}
asvrvvqknlvfvvglsqrladpevlkrpeyfgkfgkihkvvinnstsyagsqgpsasay
vtyirsedalraiqcvnnvvvdgrtlkas

SCOPe Domain Coordinates for d2cpia1:

Click to download the PDB-style file with coordinates for d2cpia1.
(The format of our PDB-style files is described here.)

Timeline for d2cpia1: