![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries) Uniprot Q8R3C6 399-484; 581-678 |
![]() | Domain d2cpha1: 2cph A:454-547 [130700] Other proteins in same PDB: d2cpha2, d2cpha3 |
PDB Entry: 2cph (more details)
SCOPe Domain Sequences for d2cpha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} qvpkkqttskilvrnipfqanqreirelfstfgelktvrlpkkmtgtgahrgfgfvdfit kqdakkafnalchsthlygrrlvlewadsevtvq
Timeline for d2cpha1: