![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
![]() | Protein RNA-binding protein EWS [143340] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [143341] (1 PDB entry) Uniprot Q01844 353-453 |
![]() | Domain d2cpea1: 2cpe A:353-453 [130698] Other proteins in same PDB: d2cpea2, d2cpea3 |
PDB Entry: 2cpe (more details)
SCOPe Domain Sequences for d2cpea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} dpdedsdnsaiyvqglndsvtlddladffkqcgvvkmnkrtgqpmihiyldketgkpkgd atvsyedpptakaavewfdgkdfqgsklkvslarkkppmns
Timeline for d2cpea1: