Lineage for d2cpda1 (2cpd A:223-308)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951865Protein APOBEC1 stimulating protein [143326] (1 species)
  7. 2951866Species Human (Homo sapiens) [TaxId:9606] [143327] (1 PDB entry)
    Uniprot Q9NQ94 223-308
  8. 2951867Domain d2cpda1: 2cpd A:223-308 [130697]
    Other proteins in same PDB: d2cpda2, d2cpda3

Details for d2cpda1

PDB Entry: 2cpd (more details)

PDB Description: solution structure of the rna recognition motif of human apobec-1 complementation factor, acf
PDB Compounds: (A:) APOBEC-1 stimulating protein

SCOPe Domain Sequences for d2cpda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]}
dedtmssvkilyvrnlmlstseemiekefnnikpgavervkkirdyafvhfsnredavea
mkalngkvldgspievtlakpvdkds

SCOPe Domain Coordinates for d2cpda1:

Click to download the PDB-style file with coordinates for d2cpda1.
(The format of our PDB-style files is described here.)

Timeline for d2cpda1: