Lineage for d2cp9a1 (2cp9 A:8-58)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636335Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 636359Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 636464Family a.5.2.2: TS-N domain [63423] (1 protein)
  6. 636465Protein Elongation factor Ts (EF-Ts), N-terminal domain [63424] (4 species)
  7. 636471Species Human (Homo sapiens), mitochondrial [TaxId:9606] [140345] (1 PDB entry)
  8. 636472Domain d2cp9a1: 2cp9 A:8-58 [130696]

Details for d2cp9a1

PDB Entry: 2cp9 (more details)

PDB Description: Solution structure of RSGI RUH-042, a UBA domain from human mitochondrial elongation factor Ts
PDB Compounds: (A:) Elongation factor Ts, mitochondrial

SCOP Domain Sequences for d2cp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp9a1 a.5.2.2 (A:8-58) Elongation factor Ts (EF-Ts), N-terminal domain {Human (Homo sapiens), mitochondrial [TaxId: 9606]}
sskellmklrrktgysfvnckkaletcggdlkqaeiwlhkeaqkegwskaa

SCOP Domain Coordinates for d2cp9a1:

Click to download the PDB-style file with coordinates for d2cp9a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp9a1: