![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.2: UBA-like [46934] (5 families) ![]() |
![]() | Family a.5.2.1: UBA domain [46935] (25 proteins) |
![]() | Protein Migration-inducing protein 19 NBR1 [140337] (1 species) Next to Brca1 gene 1 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [140338] (1 PDB entry) Uniprot Q14596 916-956 |
![]() | Domain d2cp8a1: 2cp8 A:8-48 [130695] Other proteins in same PDB: d2cp8a2, d2cp8a3 |
PDB Entry: 2cp8 (more details)
SCOPe Domain Sequences for d2cp8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} qtaalmahlfemgfcdrqlnlrllkkhnynilqvvtellql
Timeline for d2cp8a1: