![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (18 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (1 family) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (10 proteins) Pfam PF01302 |
![]() | Protein Restin [141236] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141238] (1 PDB entry) |
![]() | Domain d2cp7a1: 2cp7 A:8-78 [130694] |
PDB Entry: 2cp7 (more details)
SCOP Domain Sequences for d2cp7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cp7a1 b.34.10.1 (A:8-78) Restin {Mouse (Mus musculus) [TaxId: 10090]} frvgervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgi ftrpskltrkv
Timeline for d2cp7a1: