Lineage for d2cp5a1 (2cp5 A:8-135)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055409Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2055410Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2055459Protein Restin [141236] (2 species)
  7. 2055460Species Human (Homo sapiens) [TaxId:9606] [141237] (2 PDB entries)
    Uniprot P30622 1-128! Uniprot P30622 181-340
  8. 2055461Domain d2cp5a1: 2cp5 A:8-135 [130692]
    Other proteins in same PDB: d2cp5a2, d2cp5a3
    1st GAP-Gly domain

Details for d2cp5a1

PDB Entry: 2cp5 (more details)

PDB Description: solution structure of the 1st cap-gly domain in human clip-170/restin
PDB Compounds: (A:) Restin

SCOPe Domain Sequences for d2cp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp5a1 b.34.10.1 (A:8-135) Restin {Human (Homo sapiens) [TaxId: 9606]}
msmlkpsglkaptkilkpgstalktptavvapvektissekasstpssetqeefvddfrv
gervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgiftr
pskltrkv

SCOPe Domain Coordinates for d2cp5a1:

Click to download the PDB-style file with coordinates for d2cp5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp5a1: