Lineage for d2cp5a1 (2cp5 A:8-135)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 797091Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 797092Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 797127Protein Restin [141236] (2 species)
  7. 797128Species Human (Homo sapiens) [TaxId:9606] [141237] (3 PDB entries)
    Uniprot P30622 1-128! Uniprot P30622 181-340
  8. 797130Domain d2cp5a1: 2cp5 A:8-135 [130692]
    1st GAP-Gly domain

Details for d2cp5a1

PDB Entry: 2cp5 (more details)

PDB Description: solution structure of the 1st cap-gly domain in human clip-170/restin
PDB Compounds: (A:) Restin

SCOP Domain Sequences for d2cp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp5a1 b.34.10.1 (A:8-135) Restin {Human (Homo sapiens) [TaxId: 9606]}
msmlkpsglkaptkilkpgstalktptavvapvektissekasstpssetqeefvddfrv
gervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgiftr
pskltrkv

SCOP Domain Coordinates for d2cp5a1:

Click to download the PDB-style file with coordinates for d2cp5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp5a1: