Lineage for d2cp5a1 (2cp5 A:8-135)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665899Superfamily b.34.10: Cap-Gly domain [74924] (1 family) (S)
  5. 665900Family b.34.10.1: Cap-Gly domain [74925] (10 proteins)
    Pfam PF01302
  6. 665929Protein Restin [141236] (2 species)
  7. 665930Species Human (Homo sapiens) [TaxId:9606] [141237] (2 PDB entries)
  8. 665932Domain d2cp5a1: 2cp5 A:8-135 [130692]
    1st GAP-Gly domain

Details for d2cp5a1

PDB Entry: 2cp5 (more details)

PDB Description: Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin
PDB Compounds: (A:) Restin

SCOP Domain Sequences for d2cp5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp5a1 b.34.10.1 (A:8-135) Restin {Human (Homo sapiens) [TaxId: 9606]}
msmlkpsglkaptkilkpgstalktptavvapvektissekasstpssetqeefvddfrv
gervwvngnkpgfiqflgetqfapgqwagivldepigkndgsvagvryfqceplkgiftr
pskltrkv

SCOP Domain Coordinates for d2cp5a1:

Click to download the PDB-style file with coordinates for d2cp5a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp5a1: