Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein CLIP-115 [141230] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141231] (5 PDB entries) Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149 |
Domain d2cp3a1: 2cp3 A:8-78 [130691] Other proteins in same PDB: d2cp3a2, d2cp3a3 2nd CAP-Gly domain |
PDB Entry: 2cp3 (more details)
SCOPe Domain Sequences for d2cp3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cp3a1 b.34.10.1 (A:8-78) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]} lrlgdrvlvggtktgvvryvgetdfakgewcgveldeplgkndgavagtryfqcppkfgl fapihkvirig
Timeline for d2cp3a1: