Lineage for d2cp2a1 (2cp2 A:8-89)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2394495Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2394496Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2394500Protein CLIP-115 [141230] (1 species)
  7. 2394501Species Human (Homo sapiens) [TaxId:9606] [141231] (5 PDB entries)
    Uniprot Q9UDT6 219-289! Uniprot Q9UDT6 68-149
  8. 2394506Domain d2cp2a1: 2cp2 A:8-89 [130690]
    Other proteins in same PDB: d2cp2a2, d2cp2a3
    1st CAP-Gly domain

Details for d2cp2a1

PDB Entry: 2cp2 (more details)

PDB Description: solution structure of the 1st cap-gly domain in human clip-115/cyln2
PDB Compounds: (A:) clip-115

SCOPe Domain Sequences for d2cp2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp2a1 b.34.10.1 (A:8-89) CLIP-115 {Human (Homo sapiens) [TaxId: 9606]}
aaevgddflgdfvvgervwvngvkpgvvqylgetqfapgqwagvvlddpvgkndgavggv
ryfecpalqgiftrpskltrqp

SCOPe Domain Coordinates for d2cp2a1:

Click to download the PDB-style file with coordinates for d2cp2a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp2a1: