Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (1 family) |
Family b.34.10.1: Cap-Gly domain [74925] (10 proteins) Pfam PF01302 |
Protein CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) [117162] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141229] (1 PDB entry) Uniprot Q96DZ5 285-366 |
Domain d2cp0a1: 2cp0 A:7-89 [130689] |
PDB Entry: 2cp0 (more details)
SCOP Domain Sequences for d2cp0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cp0a1 b.34.10.1 (A:7-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]} ggnlmlsalglrlgdrvlldgqktgtlrfcgttefasgqwvgveldepegkndgsvggvr yficppkqglfasvskiskavda
Timeline for d2cp0a1: