Lineage for d2cp0a1 (2cp0 A:8-89)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784910Protein CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) [117162] (2 species)
  7. 2784911Species Human (Homo sapiens) [TaxId:9606] [141229] (1 PDB entry)
    Uniprot Q96DZ5 285-366
  8. 2784912Domain d2cp0a1: 2cp0 A:8-89 [130689]
    Other proteins in same PDB: d2cp0a2, d2cp0a3

Details for d2cp0a1

PDB Entry: 2cp0 (more details)

PDB Description: solution structure of the 1st cap-gly domain in human clip-170-related protein clipr59
PDB Compounds: (A:) CLIPR-59 protein

SCOPe Domain Sequences for d2cp0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cp0a1 b.34.10.1 (A:8-89) CLIP170-related 59kda protein CLIPR-59 (1500005P14Rik) {Human (Homo sapiens) [TaxId: 9606]}
gnlmlsalglrlgdrvlldgqktgtlrfcgttefasgqwvgveldepegkndgsvggvry
ficppkqglfasvskiskavda

SCOPe Domain Coordinates for d2cp0a1:

Click to download the PDB-style file with coordinates for d2cp0a1.
(The format of our PDB-style files is described here.)

Timeline for d2cp0a1: