SCOPe 2.07: Domain d2coza1: 2coz A:8-116

Lineage for d2coza1 (2coz A:8-116)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
   Pfam PF01302

6. Protein Centrosome-associated protein 350 [141232] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141233] (1 PDB entry)
   Uniprot Q5VT06 2473-2581

8. Domain d2coza1: 2coz A:8-116 [130688]
   Other proteins in same PDB: d2coza2, d2coza3

Details for d2coza1

PDB Entry: 2coz

PDB Description: solution structure of the cap-gly domain in human centrosome- associated protein cap350

PDB Compounds: (A:) centrosome-associated protein 350

SCOPe Domain Sequences for d2coza1:

Sequence; same for both SEQRES and ATOM records:

>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]}
veheqqvtespslasvptadelfdfhigdrvlignvqpgilrfkgetsfakgfwagveld
kpegnnngtydgiayfeckekhgifappqkishipenfddyvdineded

Timeline for d2coza1:

• d2coza1 first appeared in SCOP 1.73
  
• d2coza1 appears in SCOPe 2.06
  
• d2coza1 appears in the current release, SCOPe 2.08