Class b: All beta proteins [48724] (177 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (2 families) |
Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
Protein Centrosome-associated protein 350 [141232] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141233] (1 PDB entry) Uniprot Q5VT06 2473-2581 |
Domain d2coza1: 2coz A:8-116 [130688] Other proteins in same PDB: d2coza2, d2coza3 |
PDB Entry: 2coz (more details)
SCOPe Domain Sequences for d2coza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]} veheqqvtespslasvptadelfdfhigdrvlignvqpgilrfkgetsfakgfwagveld kpegnnngtydgiayfeckekhgifappqkishipenfddyvdineded
Timeline for d2coza1: