Lineage for d2coza1 (2coz A:8-116)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2055409Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2055410Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2055411Protein Centrosome-associated protein 350 [141232] (1 species)
  7. 2055412Species Human (Homo sapiens) [TaxId:9606] [141233] (1 PDB entry)
    Uniprot Q5VT06 2473-2581
  8. 2055413Domain d2coza1: 2coz A:8-116 [130688]
    Other proteins in same PDB: d2coza2, d2coza3

Details for d2coza1

PDB Entry: 2coz (more details)

PDB Description: solution structure of the cap-gly domain in human centrosome- associated protein cap350
PDB Compounds: (A:) centrosome-associated protein 350

SCOPe Domain Sequences for d2coza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2coza1 b.34.10.1 (A:8-116) Centrosome-associated protein 350 {Human (Homo sapiens) [TaxId: 9606]}
veheqqvtespslasvptadelfdfhigdrvlignvqpgilrfkgetsfakgfwagveld
kpegnnngtydgiayfeckekhgifappqkishipenfddyvdineded

SCOPe Domain Coordinates for d2coza1:

Click to download the PDB-style file with coordinates for d2coza1.
(The format of our PDB-style files is described here.)

Timeline for d2coza1: