Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.10: Cap-Gly domain [74924] (1 family) |
Family b.34.10.1: Cap-Gly domain [74925] (10 proteins) Pfam PF01302 |
Protein Dynactin 1 [141234] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [141235] (3 PDB entries) Uniprot Q14203 1-99! Uniprot Q14203 25-98 |
Domain d2coya1: 2coy A:8-106 [130687] |
PDB Entry: 2coy (more details)
SCOPe Domain Sequences for d2coya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2coya1 b.34.10.1 (A:8-106) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]} maqskrhvysrtpsgsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgv ildeakgkndgtvqgrkyftcdeghgifvrqsqiqvfed
Timeline for d2coya1: