Lineage for d2coya1 (2coy A:8-106)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784898Superfamily b.34.10: Cap-Gly domain [74924] (2 families) (S)
  5. 2784899Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
    Pfam PF01302
  6. 2784924Protein Dynactin 1 [141234] (1 species)
  7. 2784925Species Human (Homo sapiens) [TaxId:9606] [141235] (9 PDB entries)
    Uniprot Q14203 1-99! Uniprot Q14203 25-98
  8. 2784944Domain d2coya1: 2coy A:8-106 [130687]
    Other proteins in same PDB: d2coya2, d2coya3

Details for d2coya1

PDB Entry: 2coy (more details)

PDB Description: solution structure of the cap-gly domain in human dynactin 1
PDB Compounds: (A:) Dynactin-1

SCOPe Domain Sequences for d2coya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2coya1 b.34.10.1 (A:8-106) Dynactin 1 {Human (Homo sapiens) [TaxId: 9606]}
maqskrhvysrtpsgsrmsaeasarplrvgsrvevigkghrgtvayvgatlfatgkwvgv
ildeakgkndgtvqgrkyftcdeghgifvrqsqiqvfed

SCOPe Domain Coordinates for d2coya1:

Click to download the PDB-style file with coordinates for d2coya1.
(The format of our PDB-style files is described here.)

Timeline for d2coya1: