![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.10: Cap-Gly domain [74924] (2 families) ![]() |
![]() | Family b.34.10.1: Cap-Gly domain [74925] (11 proteins) Pfam PF01302 |
![]() | Protein Kinesin-like protein kif13b [141239] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141240] (1 PDB entry) Uniprot Q9NQT8 1684-1771 |
![]() | Domain d2cowa1: 2cow A:8-94 [130686] Other proteins in same PDB: d2cowa2, d2cowa3 |
PDB Entry: 2cow (more details)
SCOPe Domain Sequences for d2cowa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cowa1 b.34.10.1 (A:8-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]} qalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgkndg siggkqyfrcnpgygllvrpsrvrrat
Timeline for d2cowa1: