SCOPe 2.07: Domain d2cowa1: 2cow A:8-94

Lineage for d2cowa1 (2cow A:8-94)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.10: Cap-Gly domain [74924] (2 families)

5. Family b.34.10.1: Cap-Gly domain [74925] (11 proteins)
   Pfam PF01302

6. Protein Kinesin-like protein kif13b [141239] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141240] (1 PDB entry)
   Uniprot Q9NQT8 1684-1771

8. Domain d2cowa1: 2cow A:8-94 [130686]
   Other proteins in same PDB: d2cowa2, d2cowa3

Details for d2cowa1

PDB Entry: 2cow

PDB Description: solution structure of the cap-gly domain in human kinesin-like protein kif13b

PDB Compounds: (A:) Kinesin-like protein KIF13B

SCOPe Domain Sequences for d2cowa1:

Sequence; same for both SEQRES and ATOM records:

>d2cowa1 b.34.10.1 (A:8-94) Kinesin-like protein kif13b {Human (Homo sapiens) [TaxId: 9606]}
qalasdseeadevpewlregefvtvgahktgvvryvgpadfqegtwvgveldlpsgkndg
siggkqyfrcnpgygllvrpsrvrrat

Timeline for d2cowa1:

• d2cowa1 first appeared in SCOP 1.73
  
• d2cowa1 appears in SCOPe 2.06
  
• d2cowa1 appears in the current release, SCOPe 2.08