Lineage for d2cosa1 (2cos A:8-48)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2308343Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2308367Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2308368Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2308412Protein Serine/threonine protein kinase LATS2 [140341] (1 species)
  7. 2308413Species Mouse (Mus musculus) [TaxId:10090] [140342] (1 PDB entry)
    Uniprot Q7TSJ6 98-138
  8. 2308414Domain d2cosa1: 2cos A:8-48 [130683]
    Other proteins in same PDB: d2cosa2, d2cosa3

Details for d2cosa1

PDB Entry: 2cos (more details)

PDB Description: Solution structure of RSGI RUH-038, a UBA domain from Mouse LATS2 (Large Tumor Suppressor homolog 2)
PDB Compounds: (A:) Serine/threonine protein kinase LATS2

SCOPe Domain Sequences for d2cosa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]}
vnrqmlqelvnagcdqemagralkqtgsrsieaaleyiskm

SCOPe Domain Coordinates for d2cosa1:

Click to download the PDB-style file with coordinates for d2cosa1.
(The format of our PDB-style files is described here.)

Timeline for d2cosa1: