Lineage for d2cora1 (2cor A:43-73)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965176Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 1965177Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 1965315Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 1965412Protein Pinch (particularly interesting new Cys-His) protein [57741] (1 species)
  7. 1965413Species Human (Homo sapiens) [TaxId:9606] [57742] (5 PDB entries)
  8. 1965418Domain d2cora1: 2cor A:43-73 [130681]
    3rd LIM domain
    complexed with zn

Details for d2cora1

PDB Entry: 2cor (more details)

PDB Description: solution structure of the third lim domain of particularly interesting new cys-his protein
PDB Compounds: (A:) PINCH protein

SCOPe Domain Sequences for d2cora1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]}
ncancgkeltadarelkgelyclpchdkmgv

SCOPe Domain Coordinates for d2cora1:

Click to download the PDB-style file with coordinates for d2cora1.
(The format of our PDB-style files is described here.)

Timeline for d2cora1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cora2