![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (16 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.15: NOB1 zinc finger-like [144206] (1 family) ![]() |
![]() | Family g.41.15.1: NOB1 zinc finger-like [144207] (1 protein) |
![]() | Protein RNA-binding protein NOB1 (Nin one binding) [144208] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [144209] (1 PDB entry) |
![]() | Domain d2cona1: 2con A:8-73 [130680] complexed with zn |
PDB Entry: 2con (more details)
SCOP Domain Sequences for d2cona1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} vrearsyilrchgcfkttsdmnrvfcghcgnktlkkvsvtinddgtlhmhfsrnpkvlnp rglrys
Timeline for d2cona1: