Class g: Small proteins [56992] (100 folds) |
Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.15: NOB1 zinc finger-like [144206] (1 family) automatically mapped to Pfam PF08772 |
Family g.41.15.1: NOB1 zinc finger-like [144207] (1 protein) |
Protein RNA-binding protein NOB1 (Nin one binding) [144208] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [144209] (1 PDB entry) Uniprot Q8BW10 251-316 |
Domain d2cona1: 2con A:8-73 [130680] Other proteins in same PDB: d2cona2, d2cona3 complexed with zn |
PDB Entry: 2con (more details)
SCOPe Domain Sequences for d2cona1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]} vrearsyilrchgcfkttsdmnrvfcghcgnktlkkvsvtinddgtlhmhfsrnpkvlnp rglrys
Timeline for d2cona1: