Lineage for d2cona1 (2con A:8-73)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3037374Superfamily g.41.15: NOB1 zinc finger-like [144206] (1 family) (S)
    automatically mapped to Pfam PF08772
  5. 3037375Family g.41.15.1: NOB1 zinc finger-like [144207] (1 protein)
  6. 3037376Protein RNA-binding protein NOB1 (Nin one binding) [144208] (1 species)
  7. 3037377Species Mouse (Mus musculus) [TaxId:10090] [144209] (1 PDB entry)
    Uniprot Q8BW10 251-316
  8. 3037378Domain d2cona1: 2con A:8-73 [130680]
    Other proteins in same PDB: d2cona2, d2cona3
    complexed with zn

Details for d2cona1

PDB Entry: 2con (more details)

PDB Description: solution structure of rsgi ruh-035, a zn-ribbon module in mouse cdna
PDB Compounds: (A:) nin one binding protein

SCOPe Domain Sequences for d2cona1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cona1 g.41.15.1 (A:8-73) RNA-binding protein NOB1 (Nin one binding) {Mouse (Mus musculus) [TaxId: 10090]}
vrearsyilrchgcfkttsdmnrvfcghcgnktlkkvsvtinddgtlhmhfsrnpkvlnp
rglrys

SCOPe Domain Coordinates for d2cona1:

Click to download the PDB-style file with coordinates for d2cona1.
(The format of our PDB-style files is described here.)

Timeline for d2cona1: