Lineage for d2cofa1 (2cof A:8-101)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803067Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2803202Protein KIAA1914 [141407] (1 species)
  7. 2803203Species Human (Homo sapiens) [TaxId:9606] [141408] (1 PDB entry)
    Uniprot Q8N4X5 354-448
  8. 2803204Domain d2cofa1: 2cof A:8-101 [130676]
    Other proteins in same PDB: d2cofa2, d2cofa3

Details for d2cofa1

PDB Entry: 2cof (more details)

PDB Description: solution structure of the c-terminal ph domain of hypothetical protein kiaa1914 from human
PDB Compounds: (A:) Protein KIAA1914

SCOPe Domain Sequences for d2cofa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cofa1 b.55.1.1 (A:8-101) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]}
letssylnvlvnsqwksrwcsvrdnhlhfyqdrnrskvaqqplslvgcevvpdpspdhly
sfrilhkgeelakleaksseemghwlglllsesg

SCOPe Domain Coordinates for d2cofa1:

Click to download the PDB-style file with coordinates for d2cofa1.
(The format of our PDB-style files is described here.)

Timeline for d2cofa1: