SCOPe 2.07: Domain d2coda1: 2cod A:8-109

Lineage for d2coda1 (2cod A:8-109)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Centaurin-delta 1 [141395] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141396] (1 PDB entry)
   Uniprot Q8WZ64 483-584

8. Domain d2coda1: 2cod A:8-109 [130675]
   Other proteins in same PDB: d2coda2, d2coda3

Details for d2coda1

PDB Entry: 2cod

PDB Description: solution structure of the n-terminal ph domain of arap2 protein from human

PDB Compounds: (A:) Centaurin-delta 1

SCOPe Domain Sequences for d2coda1:

Sequence; same for both SEQRES and ATOM records:

>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]}
kvksgwldklspqgkrmfqkrwvkfdglsisyynnekemyskgiiplsaistvrvqgdnk
fevvttqrtfvfrvekeeerndwisillnalksqsltsqsqa

Timeline for d2coda1:

• d2coda1 first appeared in SCOP 1.73
  
• d2coda1 appears in SCOPe 2.06
  
• d2coda1 appears in the current release, SCOPe 2.08