Lineage for d2coca1 (2coc A:8-106)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1798840Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 1798914Protein FYVE, RhoGEF and PH domain containing protein 3, FGD3 [141415] (1 species)
  7. 1798915Species Human (Homo sapiens) [TaxId:9606] [141416] (1 PDB entry)
    Uniprot Q5JSP0 605-703
  8. 1798916Domain d2coca1: 2coc A:8-106 [130674]

Details for d2coca1

PDB Entry: 2coc (more details)

PDB Description: solution structure of the c-terminal ph domain of fyve, rhogef and ph domain containing protein 3 (fgd3) from human
PDB Compounds: (A:) FYVE, RhoGEF and PH domain containing protein 3

SCOPe Domain Sequences for d2coca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]}
sllcgplrlsesgetwsevwaaipmsdpqvlhlqggsqdgrlprtiplpscklsvpdpee
rldsghvwklqwakqswylsassaelqqqwletlstaah

SCOPe Domain Coordinates for d2coca1:

Click to download the PDB-style file with coordinates for d2coca1.
(The format of our PDB-style files is described here.)

Timeline for d2coca1: