![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
![]() | Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
![]() | Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins) Pfam PF00169 |
![]() | Protein FYVE, RhoGEF and PH domain containing protein 3, FGD3 [141415] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141416] (1 PDB entry) Uniprot Q5JSP0 605-703 |
![]() | Domain d2coca1: 2coc A:8-106 [130674] Other proteins in same PDB: d2coca2, d2coca3 |
PDB Entry: 2coc (more details)
SCOPe Domain Sequences for d2coca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} sllcgplrlsesgetwsevwaaipmsdpqvlhlqggsqdgrlprtiplpscklsvpdpee rldsghvwklqwakqswylsassaelqqqwletlstaah
Timeline for d2coca1: