Lineage for d2coaa1 (2coa A:8-119)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2070982Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
    Pfam PF00169
  6. 2071130Protein Protein kinase c, d2 type [141419] (1 species)
  7. 2071131Species Human (Homo sapiens) [TaxId:9606] [141420] (1 PDB entry)
    Uniprot Q9BZL6 398-509
  8. 2071132Domain d2coaa1: 2coa A:8-119 [130672]
    Other proteins in same PDB: d2coaa2, d2coaa3

Details for d2coaa1

PDB Entry: 2coa (more details)

PDB Description: solution structure of the ph domain of protein kinase c, d2 type from human
PDB Compounds: (A:) Protein kinase C, D2 type

SCOPe Domain Sequences for d2coaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]}
tlregwvvhysnkdtlrkrhywrldckcitlfqnnttnryykeiplseiltvesaqnfsl
vppgtnphcfeivtanatyfvgempggtpggpsgqgaeaargwetairqalm

SCOPe Domain Coordinates for d2coaa1:

Click to download the PDB-style file with coordinates for d2coaa1.
(The format of our PDB-style files is described here.)

Timeline for d2coaa1: