SCOPe 2.01: Domain d2co8a1: 2co8 A:44-76

Lineage for d2co8a1 (2co8 A:44-76)

1. Root: SCOPe 2.01

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.3: LIM domain [57736] (18 proteins)
   duplication: contains two (sub)domains of this fold

6. Protein Nedd9 interacting protein with calponin homology, NICAL (MICAL1) [144173] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144174] (1 PDB entry)
   Uniprot Q8TDZ2 687-722! Uniprot Q8TDZ2 723-755

8. Domain d2co8a1: 2co8 A:44-76 [130670]
   complexed with zn

Details for d2co8a1

PDB Entry: 2co8

PDB Description: solution structures of the lim domain of human nedd9 interacting protein with calponin homology and lim domains

PDB Compounds: (A:) NEDD9 interacting protein with calponin homology and LIM domains

SCOPe Domain Sequences for d2co8a1:

Sequence; same for both SEQRES and ATOM records:

>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]}
rchtceatlwpggyeqhpgdghfyclqhlpqtd

Timeline for d2co8a1:

• d2co8a1 first appeared in SCOP 1.73
  
• d2co8a1 appears in SCOP 1.75
  
• d2co8a1 appears in SCOPe 2.02
  
• d2co8a1 appears in the current release, SCOPe 2.08