Lineage for d2co7a1 (2co7 A:20-144)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 789808Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 789904Superfamily b.2.3: Bacterial adhesins [49401] (6 families) (S)
  5. 789909Family b.2.3.2: Pilus subunits [49405] (8 proteins)
  6. 789997Protein SafA pilus subunit [141080] (1 species)
  7. 789998Species Salmonella typhimurium [TaxId:90371] [141081] (10 PDB entries)
    Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170
  8. 790004Domain d2co7a1: 2co7 A:20-144 [130669]
    Other proteins in same PDB: d2co7b1, d2co7b2
    complexed with so4; mutant

Details for d2co7a1

PDB Entry: 2co7 (more details), 1.8 Å

PDB Description: salmonella enterica safa pilin in complex with the safb chaperone (type ii)
PDB Compounds: (A:) safa pilus subunit

SCOP Domain Sequences for d2co7a1:

Sequence, based on SEQRES records: (download)

>d2co7a1 b.2.3.2 (A:20-144) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]}
pqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk
ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv
vgyqp

Sequence, based on observed residues (ATOM records): (download)

>d2co7a1 b.2.3.2 (A:20-144) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]}
pqdltvslipvknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagigvglss
dslrrsdstekwngvnwmtfnsndtldivltgpaqntadtypitldvvgyqp

SCOP Domain Coordinates for d2co7a1:

Click to download the PDB-style file with coordinates for d2co7a1.
(The format of our PDB-style files is described here.)

Timeline for d2co7a1: