![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (9 proteins) |
![]() | Protein automated matches [190569] (5 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:99287] [187563] (2 PDB entries) |
![]() | Domain d2co6a_: 2co6 A: [130668] Other proteins in same PDB: d2co6b1, d2co6b2 automated match to d2co7a1 |
PDB Entry: 2co6 (more details), 2 Å
SCOPe Domain Sequences for d2co6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co6a_ b.2.3.2 (A:) automated matches {Salmonella typhimurium [TaxId: 99287]} gsdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagk ntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldv vgyqp
Timeline for d2co6a_: