Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.3: Bacterial adhesins [49401] (6 families) |
Family b.2.3.2: Pilus subunits [49405] (8 proteins) |
Protein SafA pilus subunit [141080] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [141081] (10 PDB entries) Uniprot Q8ZRK4 36-168! Uniprot Q8ZRK4 46-170 |
Domain d2co6a1: 2co6 A:22-144 [130668] Other proteins in same PDB: d2co6b1, d2co6b2 automatically matched to 2CO7 A:20-144 |
PDB Entry: 2co6 (more details), 2 Å
SCOP Domain Sequences for d2co6a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co6a1 b.2.3.2 (A:22-144) SafA pilus subunit {Salmonella typhimurium [TaxId: 90371]} dltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvdstgtawrvagknt gkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvtadtypitldvvg yqp
Timeline for d2co6a1: