Lineage for d2co3b_ (2co3 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1300526Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1300679Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1300684Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1300809Protein automated matches [190569] (7 species)
    not a true protein
  7. 1300833Species Salmonella typhimurium [TaxId:99287] [187563] (2 PDB entries)
  8. 1300834Domain d2co3b_: 2co3 B: [130666]
    Other proteins in same PDB: d2co3a1
    automated match to d2co3a1
    mutant

Details for d2co3b_

PDB Entry: 2co3 (more details), 1.78 Å

PDB Description: salmonella enterica safa pilin, head-to-tail swapped dimer of ntd1 mutant
PDB Compounds: (B:) safa pilus subunit

SCOPe Domain Sequences for d2co3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co3b_ b.2.3.2 (B:) automated matches {Salmonella typhimurium [TaxId: 99287]}
gsqksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvv
dstgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqn
vtadtypitldvvgyq

SCOPe Domain Coordinates for d2co3b_:

Click to download the PDB-style file with coordinates for d2co3b_.
(The format of our PDB-style files is described here.)

Timeline for d2co3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2co3a1