SCOP 1.73: Domain d2co3b1: 2co3 B:10-142

Lineage for d2co3b1 (2co3 B:10-142)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (6 families)

5. Family b.2.3.2: Pilus subunits [49405] (5 proteins)

6. Protein SafA pilus subunit [141080] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [141081] (8 PDB entries)

8. Domain d2co3b1: 2co3 B:10-142 [130666]
   automatically matched to 2CO3 A:10-142
   mutant

Details for d2co3b1

PDB Entry: 2co3, 1.78 Å

PDB Description: salmonella enterica safa pilin, head-to-tail swapped dimer of ntd1 mutant

PDB Compounds: (B:) safa pilus subunit

SCOP Domain Sequences for d2co3b1:

Sequence; same for both SEQRES and ATOM records:

>d2co3b1 b.2.3.2 (B:10-142) SafA pilus subunit {Salmonella typhimurium [TaxId: 602]}
qksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvds
tgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvt
adtypitldvvgy

Timeline for d2co3b1:

• d2co3b1 is new in SCOP 1.73
  
• d2co3b1 appears in SCOP 1.75
  
• d2co3b1 appears in the current release, SCOPe 2.08, called d2co3b_