![]() | Class b: All beta proteins [48724] (165 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (6 families) ![]() |
![]() | Family b.2.3.2: Pilus subunits [49405] (5 proteins) |
![]() | Protein SafA pilus subunit [141080] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [141081] (8 PDB entries) |
![]() | Domain d2co3b1: 2co3 B:10-142 [130666] automatically matched to 2CO3 A:10-142 mutant |
PDB Entry: 2co3 (more details), 1.78 Å
SCOP Domain Sequences for d2co3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2co3b1 b.2.3.2 (B:10-142) SafA pilus subunit {Salmonella typhimurium [TaxId: 602]} qksvdivfsspqdltvslipvsglkagknapsakiaklvvnsttlkefgvrgisnnvvds tgtawrvagkntgkeigvglssdslrrsdstekwngvnwmtfnsndtldivltgpaqnvt adtypitldvvgy
Timeline for d2co3b1: